RegulonDB RegulonDB 10.8: Amino acid Sequence
lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase Amino Acid Sequence


Size: 550

Fasta

 

>lipid IVA 4-amino-4-deoxy-L-arabinosyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MKSVRYLIGLFAFIACYYLLPISTRLLWQPDETRYAEISREMLASGDWIVPHLLGLRYFE
KPIAGYWINSIGQWLFGANNFGVRAGVIFATLLTAALVTWFTLRLWRDKRLALLATVIYL
SLFIVYAIGTYAVLDPFIAFWLVAGMCSFWLAMQAQTWKGKSAGFLLLGITCGMGVMTKG
FLALAVPVLSVLPWVATQKRWKDLFIYGWLAVISCVLTVLPWGLAIAQREPNFWHYFFWV
EHIQRFALDDAQHRAPFWYYVPVIIAGSLPWLGLLPGALYTGWKNRKHSATVYLLSWTIM
PLLFFSVAKGKLPTYILSCFASLAMLMAHYALLAAKNNPLALRINGWINIAFGVTGIIAT
FVVSPWGPMNTPVWQTFESYKVFCAWSIFSLWAFFGWYTLTNVEKTWPFAALCPLGLALL
VGFSIPDRVMEGKHPQFFVEMTQESLQPSRYILTDSVGVAAGLAWSLQRDDIIMYRQTGE
LKYGLNYPDAKGRFVSGDEFANWLNQHRQEGIITLVLSVDRDEDINSLAIPPADAIDRQE
RLVLIQYRPK
              
                            

Download fasta file
RegulonDB