RegulonDB RegulonDB 10.8: Amino acid Sequence
putative endonuclease SmrB Amino Acid Sequence


Size: 183

Fasta

 

>putative endonuclease SmrB E. coli K12. Version NC_000913.3 GI:556503834
MKKKTTLSEEDQALFRQLMAGTRKIKQDTIVHRPQRKKISEVPVKRLIQEQADASHYFSD
EFQPLLNTEGPVKYVRPDVSHFEAKKLRRGDYSPELFLDLHGLTQLQAKQELGALIAACR
REHVFCACVMHGHGKHILKQQTPLWLAQHPHVMAFHQAPKEYGGDAALLVLIEVEEWLPP
ELP
              
                            

Download fasta file
RegulonDB