RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF2544 domain-containing protein YfcO Amino Acid Sequence


Size: 273

Fasta

 

>DUF2544 domain-containing protein YfcO E. coli K12. Version NC_000913.3 GI:556503834
MKILRWLFALVMLIATTEAMAAGHSVDVYYGYNGDSRNIATFNLKIMMPSAVYVGEYKSS
QWLMTGEILQNVSWSGPPPAPSVKLIGYHQNINKASCPGLPSGWNCGYYTFEVIVSAEIE
SYFSCPWLVIMNDSEASPGGVTYQGPDSHDTICPSVSVQPYDVSWNENYVSKSKLLTLQS
TGGVVEKTLSTYLMKDGKLCDSTQMNETGGYCRWVAQMITFTASGCDKAEVSVTPNRHPI
TDKQLHDMVVRVDTSSMQPIDSTCRFQYILNEL
              
                            

Download fasta file
RegulonDB