RegulonDB RegulonDB 10.8: Amino acid Sequence
putative outer membrane usher protein YfcU Amino Acid Sequence


Size: 881

Fasta

 

>putative outer membrane usher protein YfcU E. coli K12. Version NC_000913.3 GI:556503834
MPDHSLFRLRILPWCIALAMSGSYSSVWAEDDIQFDSRFLELKGDTKIDLKRFSSQGYVE
PGKYNLQVQLNKQPLAEEYDIYWYAGEDDVSKSYACLTPELVAQFGLKEDVAKNLQWSHD
GKCLKPGQLEGVEIKADLSQSALVISLPQAYLEYTWPDWDPPSRWDDGISGIIADYSITA
QTRHEENGGDDSNEISGNGTVGVNLGPWRMRADWQTNYQHTRSNDDDDEFGGDDTQKKWE
WSRYYAWRALPSLKAKLALGEDYLNSDIFDGFNYVGGSVSTDDQMLPPNLRGYAPDISGV
AHTTAKVTVSQMGRVIYETQVPAGPFRIQDLGDSVSGTLHIRIEEQNGQVQEYDISTASM
PYLTRPGQVRYKIMMGRPQEWGHHVEGGFFSGAEASWGIANGWSLYGGALGDENYQSAAL
GVGRDLSTFGAVAFDVTHSHTKLDKDTAYGKGSLDGNSFRVSYSKDFDQLNSRVTFAGYR
FSEENFMTMSEYLDASDSEMVRTGNDKEMYTATYNQNFRDAGVSVYLNYTRHTYWDREEQ
TNYNIMLSHYFNMGSIRNMSVSLTGYRYEYDNRADKGM*ISLSMPWGDNSTVSYNGNYGS
GTDSSQVGYFSRVDDATHYQLNIGTSDKHTSVDGYYSHDGSLAQVDLSANYHEGQYTSAG
LSLQGGATLTTHGGALHRTQNMGGTRLLIDADGVADVPVEGNGAAVYTNMFGKAVVSDVN
NYYRNQAYIDLNKLPENAEATQSVVQATLTEGAIGYRKFAVISGQKAMAVLRLQDGSHPP
FGAEVKNDNEQTVGLVDDDGSVYLAGVKPGEHMSVFWSGVAHCDINLPDPLPADLFNGLL
LPCQHKGNVAPVVPDDIKPVIQEQTQQVTPTDPPVSVSANQ
              
                            

Download fasta file
RegulonDB