RegulonDB RegulonDB 10.9: Amino acid Sequence
tripartite efflux pump membrane fusion protein EmrK Amino Acid Sequence


Size: 387

Fasta

 

>tripartite efflux pump membrane fusion protein EmrK E. coli K12. Version NC_000913.3 GI:556503834
MEQINSNKKHSNRRKYFSLLAVVLFIAFSGAYAYWSMELEDMISTDDAYVTGNADPISAQ
VSGSVTVVNHKDTNYVRQGDILVSLDKTDATIALNKAKNNLANIVRQTNKLYLQDKQYSA
EVASARIQYQQSLEDYNRRVPLAKQGVISKETLEHTKDTLISSKAALNAAIQAYKANKAL
VMNTPLNRQPQVVEAADATKEAWLALKRTDIKSPVTGYIAQRSVQVGETVSPGQSLMAVV
PARQMWVNANFKETQLTDVRIGQSVNIISDLYGENVVFHGRVTGINMGTGNAFSLLPAQN
ATGNWIKIVQRVPVEVSLDPKELMEHPLRIGLSMTATIDTKNEDIAEMPELASTVTSMPA
YTSKALVIDTSPIEKEISNIISHNGQL
              
                            

Download fasta file
RegulonDB