RegulonDB RegulonDB 10.8: Amino acid Sequence
acetyl-CoA:oxalate CoA-transferase Amino Acid Sequence


Size: 381

Fasta

 

>acetyl-CoA:oxalate CoA-transferase E. coli K12. Version NC_000913.3 GI:556503834
MTNNESKGPFEGLLVIDMTHVLNGPFGTQLLCNMGARVIKVEPPGHGDDTRTFGPYVDGQ
SLYYSFINHGKESVVLDLKNDHDKSIFINMLKQADVLAENFRPGTMEKLGFSWETLQEIN
PRLIYASSSGFGHTGPLKDAPAYDTIIQAMSGIMMETGYPDAPPVRVGTSLADLCGGVYL
FSGIVSALYGREKSQRGAHVDIAMFDATLSFLEHGLMAYIATGKSPQRLGNRHPYMAPFD
VFNTQDKPITICCGNDKLFSALCQALELTELVNDPRFSSNILRVQNQAILKQYIERTLKT
QAAEVWLARIHEVGVPVAPLLSVAEAIKLPQTQARNMLIEAGGIMMPGNPIKISGCADPH
VMPGAATLDQHGEQIRQEFSS
              
                            

Download fasta file
RegulonDB