RegulonDB RegulonDB 10.8: Amino acid Sequence
putative transport protein YfdV Amino Acid Sequence


Size: 314

Fasta

 

>putative transport protein YfdV E. coli K12. Version NC_000913.3 GI:556503834
MLTFFIGDLLPIIVIMLLGYFSGRRETFSEDQARAFNKLVLNYALPAALFVSITRANREM
IFADTRLTLVSLVVIVGCFFFSWFGCYKFFKRTHAEAAVCALIAGSPTIGFLGFAVLDPI
YGDSVSTGLVVAIISIIVNAITIPIGLYLLNPSSGADGKKNSNLSALISAAKEPVVWAPV
LATILVLVGVKIPAAWDPTFNLIAKANSGVAVFAAGLTLAAHKFEFSAEIAYNTFLKLIL
MPLALLLVGMACHLNSEHLQMMVLAGALPPAFSGIIIASRFNVYTRTGTASLAVSVLGFV
VTAPLWIYVSRLVS
              
                            

Download fasta file
RegulonDB