RegulonDB RegulonDB 10.8: Amino acid Sequence
colanic acid synthesis putative lipoprotein YpdI Amino Acid Sequence


Size: 91

Fasta

 

>colanic acid synthesis putative lipoprotein YpdI E. coli K12. Version NC_000913.3 GI:556503834
MKVNLILFSLFLLVSIMACNVFAFSISGGGSERSYKETEKTSAMTTTHSTKLQPSQAILF
KMREDAPPLNLTEEMPPPFPTKANYLIHPVR
              
                            

Download fasta file
RegulonDB