RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF2545 domain-containing protein YfdY Amino Acid Sequence


Size: 80

Fasta

 

>DUF2545 domain-containing protein YfdY E. coli K12. Version NC_000913.3 GI:556503834
MINLWMFLALCIVCVSGYIGQVLNVVSAVSSFFGMVILAALIYYFTMWLTGGNELVTGIF
MFLAPACGLMIRFMVGYGRR
              
                            

Download fasta file
RegulonDB