RegulonDB RegulonDB 10.8: Amino acid Sequence
DNA-binding transcriptional activator PyrR Amino Acid Sequence


Size: 244

Fasta

 

>DNA-binding transcriptional activator PyrR E. coli K12. Version NC_000913.3 GI:556503834
MKVIIVEDEFLAQQELSWLIKEHSQMEIVGTFDDGLDVLKFLQHNRVDAIFLDINIPSLD
GVLLAQNISQFAHKPFIVFITAWKEHAVEAFELEAFDYILKPYQESRITGMLQKLEAAWQ
QQQTSSTPAATVTRENDTINLVKDERIIVTPINDIYYAEAHEKMTFVYTRRESYVMPMNI
TEFCSKLPPSHFFRCHRSFCVNLNKIREIEPWFNNTYILRLKDLDFEVPVSRSKVKEFRQ
LMHL
              
                            

Download fasta file
RegulonDB