RegulonDB RegulonDB 10.9: Amino acid Sequence
cell division protein ZipA Amino Acid Sequence


Size: 328

Fasta

 

>cell division protein ZipA E. coli K12. Version NC_000913.3 GI:556503834
MMQDLRLILIIVGAIAIIALLVHGFWTSRKERSSMFRDRPLKRMKSKRDDDSYDEDVEDD
EGVGEVRVHRVNHAPANAQEHEAARPSPQHQYQPPYASAQPRQPVQQPPEAQVPPQHAPH
PAQPVQQPAYQPQPEQPLQQPVSPQVAPAPQPVHSAPQPAQQAFQPAEPVAAPQPEPVAE
PAPVMDKPKRKEAVIIMNVAAHHGSELNGELLLNSIQQAGFIFGDMNIYHRHLSPDGSGP
ALFSLANMVKPGTFDPEMKDFTTPGVTIFMQVPSYGDELQNFKLMLQSAQHIADEVGGVV
LDDQRRMMTPQKLREYQDIIREVKDANA
              
                            

Download fasta file
RegulonDB