RegulonDB RegulonDB 10.8: Amino acid Sequence
zinc ribbon domain-containing protein YfgJ Amino Acid Sequence


Size: 71

Fasta

 

>zinc ribbon domain-containing protein YfgJ E. coli K12. Version NC_000913.3 GI:556503834
MELHCPQCQHVLDQDNGHARCRSCGEFIEMKALCPDCHQPLQVLKACGAVDYFCQHGHGL
ISKKRVEFVLA
              
                            

Download fasta file
RegulonDB