RegulonDB RegulonDB 10.8: Amino acid Sequence
stationary phase inducible protein CsiE Amino Acid Sequence


Size: 426

Fasta

 

>stationary phase inducible protein CsiE E. coli K12. Version NC_000913.3 GI:556503834
MMPTLAPPSVLSAPQRRCQILLTLFQPGLTATMATFSELNGVDDDIASLDISETGREILR
YHQLTLTTGYDGSYRVEGTVLNQRLCLFHWLRRGFRLCPSFITSQFTPALKSELKRRGIA
RNFYDDTNLQALVNLCSRRLQKRFESRDIHFLCLYLQYCLLQHHAGITPQFNPLQRRWAE
SCLEFQVAQEIGRHWQRRALQPVPPDEPLFMALLFSMLRVPDPLRDAHQRDRQLRQSIKR
LVNHFRELGNVRFYDEQGLCDQLYTHLAQALNRSLFAIGIDNTLPEEFARLYPRLVRTTR
AALAGFESEYGVHLSDEESGLVAVIFGAWLMQENDLHEKQIILLTGNDSEREAQIEQQLR
ELTLLPLNIKHMSVKAFLQTGAPRGAALIIAPYTMPLPLFSPPLIYTDLTLTTHQQEQIR
KMLESA
              
                            

Download fasta file
RegulonDB