RegulonDB RegulonDB 10.8: Amino acid Sequence
2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase Amino Acid Sequence


Size: 270

Fasta

 

>2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MSDLHNESIFITGGGSGLGLALVERFIEEGAQVATLELSAAKVASLRQRFGEHILAVEGN
VTCYADYQRAVDQILTRSGKLDCFIGNAGIWDHNASLVNTPAETLETGFHELFNVNVLGY
LLGAKACAPALIASEGSMIFTLSNAAWYPGGGGPLYTASKHAATGLIRQLAYELAPKVRV
NGVGPCGMASDLRGPQALGQSETSIMQSLTPEKIAAILPLQFFPQPADFTGPYVMLTSRR
NNRALSGVMINADAGLAIRGIRHVAAGLDL
              
                            

Download fasta file
RegulonDB