RegulonDB RegulonDB 10.8: Amino acid Sequence
putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin reductase subunit Amino Acid Sequence


Size: 400

Fasta

 

>putative 3-phenylpropionate/cinnamate dioxygenase ferredoxin reductase subunit E. coli K12. Version NC_000913.3 GI:556503834
MKEKTIIIVGGGQAAAMAAASLRQQGFTGELHLFSDERHLPYERPPLSKSMLLEDSPQLQ
QVLPANWWQENNVHLHSGVTIKTLGRDTRELVLTNGESWHWDQLFIATGAAARPLPLLDA
LGERCFTLRHAGDAARLREVLQPERSVVIIGAGTIGLELAASATQRRCKVTVIELAATVM
GRNAPPPVQRYLLQRHQQAGVRILLNNAIEHVVDGEKVELTLQSGETLQADVVIYGIGIS
ANEQLAREANLDTANGIVIDEACRTCDPAIFAGGDVAITRLDNGALHRCESWENANNQAQ
IAAAAMLGLPLPLLPPPWFWSDQYSDNLQFIGDMRGDDWLCRGNPETQKAIWFNLQNGVL
IGAVTLNQGREIRPIRKWIQSGKTFDAKLLIDENIALKSL
              
                            

Download fasta file
RegulonDB