RegulonDB RegulonDB 10.8: Amino acid Sequence
putative ABC transporter periplasmic binding protein YphF Amino Acid Sequence


Size: 327

Fasta

 

>putative ABC transporter periplasmic binding protein YphF E. coli K12. Version NC_000913.3 GI:556503834
MPTKMRTTRNLLLMATLLGSALFARAAEKEMTIGAIYLDTQGYYAGVRQGVQDAAKDSSV
QVQLIETNAQGDISKESTFVDTLVARNVDAIILSAVSENGSSRTVRRASEAGIPVICYNT
CINQKGVDKYVSAYLVGDPLEFGKKLGNAAADYFIANKIDQPKIAVINCEAFEVCVQRRK
GFEEVLKSRVPGAQIVANQEGTVLDKAISVGEKLIISTPDLNAIMGESGGATLGAVKAVR
NQNQAGKIAVFGSDMTTEIAQELENNQVLKAVVDISGKKMGNAVFAQTLKVINKQADGEK
VIQVPIDLYTKTEDGKQWLATHVDGLP
              
                            

Download fasta file
RegulonDB