RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF5107 domain-containing protein YphG Amino Acid Sequence


Size: 1093

Fasta

 

>DUF5107 domain-containing protein YphG E. coli K12. Version NC_000913.3 GI:556503834
MTPVKVWQERVEIPTYETGPQDIHPMFLENRVYQGSSGAVYPYGVTDTLSEQKTLKSWQA
VWLENDYIKVMILPELGGRVHRAWDKVKQRDFVYHNEVIKPALVGLLGPWISGGIEFNWP
QHHRPTTFMPVDFTLEAHEDGAQTVWVGETEPMHGLQVMTGFTLRPDRAALEIASRVYNG
NATPRHFLWWANPAVKGGEGHQSVFPPDVTAVFDHGKRAVSAFPIATGTYYKVDYSAGVD
ISRYKNVPVPTSYMAEKSQYDFVGAWCHDEDGGLLHVANHHIAPGKKQWSWGHSEFGQAW
DKSLTDNNGPYIELMTGIFADNQPDFTWLDAYEEKRFEQYFLPYHSLGMVQNASRDAVIK
LQRSKRGIEWGLYAISPLNGYRLAIREIGKCNALLDDAVALMPATAIQGVLHGINPERLT
IELSDADGNIVLSYQEHQPQALPLPDVAKAPLAAQDITSTDEAWFIGQHLEQYHHASRSP
FDYYLRGVALDPLDYRCNLALAMLEYNRADFPQAVAYATQALKRAHALNKNPQCGQASLI
RASAYERQGQYQQAEEDFWRAVWSGNSKAGGYYGLARLAARNGNFDAGLDFCQQSLRACP
TNQEVLCLHNLLLVLSGRQDNARVQREKLLRDYPLNATLWWLNWFDGRSESALAQWRGLC
QGRDVNALMTAGQLINWGMPTLAAEMLNALDCQRTLPLYLQASLLPKAERGELVAKAIDV
FPQFVRFPNTLEEVAALESIEECWFARHLLACFYYNKRSYNKAIAFWQRCVEMSPEFADG
WRGLAIHAWNKQHDYELAARYLDNAYQLAPQDARLLFERDLLDKLSGATPEKRLARLENN
LEIALKRDDMTAELLNLWHLTGQADKAADILATRKFHPWEGGEGKVTSQFILNQLLRAWQ
HLDARQPQQACELLHAALHYPENLSEGRLPGQTDNDIWFWQAICANAQGDETEATRCLRL
AATGDRTINIHSYYNDQPVDYLFWQGMALRLLGEQQTAQQLFSEMKQWAQEMAKTSIEAD
FFAVSQPDLLSLYGDLQQQHKEKCLMVAMLASAGLGEVAQYESARAELTAINPAWPKAAL
FTTVMPFIFNRVH
              
                            

Download fasta file
RegulonDB