RegulonDB RegulonDB 10.8: Amino acid Sequence
anti-sigma factor stabilizing protein RseB Amino Acid Sequence


Size: 318

Fasta

 

>anti-sigma factor stabilizing protein RseB E. coli K12. Version NC_000913.3 GI:556503834
MKQLWFAMSLVTGSLLFSANASATPASGALLQQMNLASQSLNYELSFISINKQGVESLRY
RHARLDNRPLAQLLQMDGPRREVVQRGNEISYFEPGLEPFTLNGDYIVDSLPSLIYTDFK
RLSPYYDFISVGRTRIADRLCEVIRVVARDGTRYSYIVWMDTESKLPMRVDLLDRDGETL
EQFRVIAFNVNQDISSSMQTLAKANLPPLLSVPVGEKAKFSWTPTWLPQGFSEVSSSRRP
LPTMDNMPIESRLYSDGLFSFSVNVNRATPSSTDQMLRTGRRTVSTSVRDNAEITIVGEL
PPQTAKRIAENIKFGAAQ
              
                            

Download fasta file
RegulonDB