RegulonDB RegulonDB 10.9: Amino acid Sequence
peptidyl-lysine N-acetyltransferase Amino Acid Sequence


Size: 886

Fasta

 

>peptidyl-lysine N-acetyltransferase E. coli K12. Version NC_000913.3 GI:556503834
MSQRGLEALLRPKSIAVIGASMKPNRAGYLMMRNLLAGGFNGPVLPVTPAWKAVLGVLAW
PDIASLPFTPDLAVLCTNASRNLALLEELGEKGCKTCIILSAPASQHEDLRACALRHNMR
LLGPNSLGLLAPWQGLNASFSPVPIKRGKLAFISQSAAVSNTILDWAQQRKMGFSYFIAL
GDSLDIDVDELLDYLARDSKTSAILLYLEQLSDARRFVSAARSASRNKPILVIKSGRSPA
AQRLLNTTAGMDPAWDAAIQRAGLLRVQDTHELFSAVETLSHMRPLRGDRLMIISNGAAP
AALALDALWSRNGKLATLSEETCQKLRDALPEHVAISNPLDLRDDASSEHYIKTLDILLH
SQDFDALMVIHSPSAAAPATESAQVLIEAVKHHPRSKYVSLLTNWCGEHSSQEARRLFSE
AGLPTYRTPEGTITAFMHMVEYRRNQKQLRETPALPSNLTSNTAEAHLLLQQAIAEGATS
LDTHEVQPILQAYGMNTLPTWIASDSTEAVHIAEQIGYPVALKLRSPDIPHKSEVQGVML
YLRTANEVQQAANAIFDRVKMAWPQARVHGLLVQSMANRAGAQELRVVVEHDPVFGPLIM
LGEGGVEWRPEDQAVVALPPLNMNLARYLVIQGIKSKKIRARSALRPLDVAGLSQLLVQV
SNLIVDCPEIQRLDIHPLLASGSEFTALDVTLDISPFEGDNESRLAVRPYPHQLEEWVEL
KNGERCLFRPILPEDEPQLQQFISRVTKEDLYYRYFSEINEFTHEDLANMTQIDYDREMA
FVAVRRIDQTEEILGVTRAISDPDNIDAEFAVLVRSDLKGLGLGRRLMEKLITYTRDHGL
QRLNGITMPNNRGMVALARKLGFNVDIQLEEGIVGLTLNLAQREES
              
                            

Download fasta file
RegulonDB