RegulonDB RegulonDB 10.8: Amino acid Sequence
cytochrome c assembly family protein Amino Acid Sequence


Size: 263

Fasta

 

>cytochrome c assembly family protein E. coli K12. Version NC_000913.3 GI:556503834
MPVFALLALVAYSVSLALIVPGLLQKNGGWRRMAIISAVIALVCHAIALEARILPDGDSG
QNLSLLNVGSLVSLMICTVMTIVASRNRGWLLLPIVYAFALINLALATFMPNEYITHLEA
TPGMLVHIGLSLFSYATLIIAALYALQLAWIDYQLKNKKLAFNQEMPPLMSIERKMFHIT
QIGVVLLTLTLCTGLFYMHNLFSMENIDKAVLSIVAWFVYIVLLWGHYHEGWRGRRVVWF
NVAGAVILTLAYFGSRIVQQLIS
              
                            

Download fasta file
RegulonDB