RegulonDB RegulonDB 11.1: Amino acid Sequence
CP4-57 prophage; uncharacterized protein YfjH Amino Acid Sequence


Size: 318

Fasta

 

>CP4-57 prophage; protein YfjH E. coli K12. Version NC_000913.3 GI:556503834
MGIFKAKNPCTKNTIFTTSNTLIYGGFMISLNDFYEQICRKRRDLAYHMSECEWAVDTDV
LEEDHPEIRIELGRMREQFWSSEKIGTRVRLYSCDVPWETRHHTVNGQLEIKEEYTELYD
PAQECWKNLSSNLTKETFLPLVIEPFSINDIFKAHLMFASISFFWGKSIMSENENVAFKA
FHRAAELFDKCIGMTWFNISVCNQKKLSEVRRSAGKKGGKSKAEVYHIIQLKLVELINDS
VPNDGWKNKVVAVNELIEPLWDFIQMSEFEINNQNKKYRVATMSQDALVDTILNQWSLKN
EDVKQAFDSAVRRKKRSK
              
                            

Download fasta file
RegulonDB