RegulonDB RegulonDB 10.8: Amino acid Sequence
Pmp3 family protein YqaE Amino Acid Sequence


Size: 52

Fasta

 

>Pmp3 family protein YqaE E. coli K12. Version NC_000913.3 GI:556503834
MGFWRIVITIILPPLGVLLGKGFGWAFIINILLTLLGYIPGLIHAFWVQTRD
              
                            

Download fasta file
RegulonDB