RegulonDB RegulonDB 10.8: Amino acid Sequence
dimanganese-tyrosyl radical cofactor maintenance flavodoxin NrdI Amino Acid Sequence


Size: 136

Fasta

 

>dimanganese-tyrosyl radical cofactor maintenance flavodoxin NrdI E. coli K12. Version NC_000913.3 GI:556503834
MSQLVYFSSSSENTQRFIERLGLPAVRIPLNERERIQVDEPYILIVPSYGGGGTAGAVPR
QVIRFLNDEHNRALLRGVIASGNRNFGEAYGRAGDVIARKCGVPWLYRFELMGTQSDIEN
VRKGVTEFWQRQPQNA
              
                            

Download fasta file
RegulonDB