RegulonDB RegulonDB 10.8: Amino acid Sequence
L-valine exporter, YgaZ component Amino Acid Sequence


Size: 245

Fasta

 

>L-valine exporter, YgaZ component E. coli K12. Version NC_000913.3 GI:556503834
MESPTPQPAPGSATFMEGCKDSLPIVISYIPVAFAFGLNATRLGFSPLESVFFSCIIYAG
ASQFVITAMLAAGSSLWIAALTVMAMDVRHVLYGPSLRSRIIQRLQKSKTALWAFGLTDE
VFAAATAKLVRNNRRWSENWMIGIAFSSWSSWVFGTVIGAFSGSGLLQGYPAVEAALGFM
LPALFMSFLLASFQRKQSLCVTAALVGALAGVTLFSIPVAILAGIVCGCLTALIQAFWQG
APDEL
              
                            

Download fasta file
RegulonDB