RegulonDB RegulonDB 11.1: Amino acid Sequence
fructose-1-phosphate phosphatase YqaB Amino Acid Sequence


Size: 188

Fasta

 

>fructose-1-phosphatase E. coli K12. Version NC_000913.3 GI:556503834
MYERYAGLIFDMDGTILDTEPTHRKAWREVLGHYGLQYDIQAMIALNGSPTWRIAQAIIE
LNQADLDPHALAREKTEAVRSMLLDSVEPLPLVDVVKSWHGRRPMAVGTGSESAIAEALL
AHLGLRHYFDAVVAADHVKHHKPAPDTFLLCAQRMGVQPTQCVVFEDADFGIQAARAAGM
DAVDVRLL
              
                            

Download fasta file
RegulonDB