RegulonDB RegulonDB 10.8: Amino acid Sequence
putative 3-oxo-tetronate 4-phosphate decarboxylase YgbL Amino Acid Sequence


Size: 212

Fasta

 

>putative 3-oxo-tetronate 4-phosphate decarboxylase YgbL E. coli K12. Version NC_000913.3 GI:556503834
MSDFAKVEQSLREEMTRIASSFFQRGYATGSAGNLSLLLPDGNLLATPTGSCLGNLDPQR
LSKVAADGEWLSGDKPSKEVLFHLALYRNNPRCKAVVHLHSTWSTALSCLQGLDSSNVIR
PFTPYVVMRMGNVPLVPYYRPGDKRIAQDLAELAADNQAFLLANHGPVVCGESLQEAANN
MEELEETAKLIFILGDRPIRYLTAGEIAELRS
              
                            

Download fasta file
RegulonDB