RegulonDB RegulonDB 10.8: Amino acid Sequence
putative deoxygluconate dehydrogenase Amino Acid Sequence


Size: 261

Fasta

 

>putative deoxygluconate dehydrogenase E. coli K12. Version NC_000913.3 GI:556503834
MSIESLNAFSMDFFSLKGKTAIVTGGNSGLGQAFAMALAKAGANIFIPSFVKDNGETKEM
IEKQGVEVDFMQVGITAEGAPQKIIAACCERFGTVDILVNNAGICKLNKVLDFGRADWDP
MIDVNLTAAFELSYEAAKIMIPQKSGKIINICSLFSYLGGQWSPAYSATKHALAGFTKAY
CDELGQYNIQVNGIAPGYYATDITLATRSNPETNQRVLDHIPANRWGDTQDLMGAAVFLA
SPASNYVNGHLLVVDGGYLVR
              
                            

Download fasta file
RegulonDB