RegulonDB RegulonDB 10.8: Amino acid Sequence
putative sugar kinase YgcE Amino Acid Sequence


Size: 492

Fasta

 

>putative sugar kinase YgcE E. coli K12. Version NC_000913.3 GI:556503834
MSKKYIIGIDGGSQSTKVVMYDLEGNVVCEGKGLLQPMHTPDADTAEHPDDDLWASLCFA
GHDLMSQFAGNKEDIVGIGLGSIRCCRALLKADGTPAAPLISWQDARVTRPYEHTNPDVA
YVTSFSGYLTHRLTGEFKDNIANYFGQWPVDYKSWAWSEDAAVMDKFNIPRHMLFDVQMP
GTVLGHITPQAALATHFPAGLPVVCTTSDKPVEALGAGLLDDETAVISLGTYIALMMNGK
ALPKDPVAYWPIMSSIPQTLLYEGYGIRKGMWTVSWLRDMLGESLIQDARAQDLSPEDLL
NKKASCVPPGCNGLMTVLDWLTNPWEPYKRGIMIGFDSSMDYAWIYRSILESVALTLKNN
YDNMCNEMNHFAKHVIITGGGSNSDLFMQIFADVFNLPARRNAINGCASLGAAINTAVGL
GLYPDYATAVDNMVRVKDIFIPIESNAKRYDAMNKGIFKDLTKHTDVILKKSYEVMHGEL
GNVDSIQSWSNA
              
                            

Download fasta file
RegulonDB