RegulonDB RegulonDB 10.8: Amino acid Sequence
protein YgcG Amino Acid Sequence


Size: 290

Fasta

 

>protein YgcG E. coli K12. Version NC_000913.3 GI:556503834
MRYFILMFTFVCSFVAAQPTIVPQLQQQVTDLTSSLNSQEKKELTHKLESIFNNTQVQIA
VLIVPTTKDETIEQYATRVFDNWRLGDAKRNDGILIVVAWSDRTVRIQVGYGLEEKVTDA
LAGDIIRSNMIPAFKQQKLAKGLELAINALNNQLTSQHQYPTNPSESESASSSDHYYFAI
FWVFAVMFFPFWFFHQGSNFCRACKSGVCISAIYLLDLFLFSDKIFSIAVFSFFFTFTIF
MVFTCLCVLQKRASGRSYHSDNSGSAGGSDSGGFSGGGGSSGGGGASGRW
              
                            

Download fasta file
RegulonDB