RegulonDB RegulonDB 10.8: Amino acid Sequence
glucarate dehydratase-related protein Amino Acid Sequence


Size: 446

Fasta

 

>glucarate dehydratase-related protein E. coli K12. Version NC_000913.3 GI:556503834
MATQSSPVITDMKVIPVAGHDSMLLNIGGAHNAYFTRNIVVLTDNAGHTGIGEAPGGDVI
YQTLVDAIPMVLGQEVARLNKVVQQVHKGNQAADFDTFGKGAWTFELRVNAVAALEAALL
DLLGKALNVPVCELLGPGKQREAITVLGYLFYIGDRTKTDLPYVENTPGNHEWYQLRHQK
AMNSEAVVRLAEASQDRYGFKDFKLKGGVLPGEQEIDTVRALKKRFPDARITVDPNGAWL
LDEAISLCKGLNDVLTYAEDPCGAEQGFSGREVMAEFRRATGLPVATNMIATNWREMGHA
VMLNAVDIPLADPHFWTLSGAVRVAQLCDDWGLTWGCHSNNHFDISLAMFTHVGAAAPGN
PTAIDTHWIWQEGDCRLTQNPLEIKNGKIAVPDAPGLGVELDWEQVQKAHEAYKRLPGGA
RNDAGPMQYLIPGWTFDRKRPVFGRH
              
                            

Download fasta file
RegulonDB