RegulonDB RegulonDB 10.8: Amino acid Sequence
galactarate/D-glucarate transporter GudP Amino Acid Sequence


Size: 450

Fasta

 

>galactarate/D-glucarate transporter GudP E. coli K12. Version NC_000913.3 GI:556503834
MSSLSQAASSVEKRTNARYWIVVMLFIVTSFNYGDRATLSIAGSEMAKDIGLDPVGMGYV
FSAFSWAYVIGQIPGGWLLDRFGSKRVYFWSIFIWSMFTLLQGFVDIFSGFGIIVALFTL
RFLVGLAEAPSFPGNSRIVAAWFPAQERGTAVSIFNSAQYFATVIFAPIMGWLTHEVGWS
HVFFFMGGLGIVISFIWLKVIHEPNQHPGVNKKELEYIAAGGALINMDQQNTKVKVPFSV
KWGQIKQLLGSRMMIGVYIGQYCINALTYFFITWFPVYLVQARGMSILKAGFVASVPAVC
GFIGGVLGGIISDWLMRRTGSLNIARKTPIVMGMLLSMVMVFCNYVNVEWMIIGFMALAF
FGKGIGALGWAVMADTAPKEISGLSGGLFNMFGNISGIVTPIAIGYIVGTTGSFNGALIY
VGVHALIAVLSYLVLVGDIKRIELKPVAGQ
              
                            

Download fasta file
RegulonDB