RegulonDB RegulonDB 10.8: Amino acid Sequence
tRNA pseudouridine65 synthase Amino Acid Sequence


Size: 260

Fasta

 

>tRNA pseudouridine65 synthase E. coli K12. Version NC_000913.3 GI:556503834
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLTIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
              
                            

Download fasta file
RegulonDB