RegulonDB RegulonDB 10.8: Amino acid Sequence
DUF446 domain-containing protein YqcC Amino Acid Sequence


Size: 109

Fasta

 

>DUF446 domain-containing protein YqcC E. coli K12. Version NC_000913.3 GI:556503834
MTTHDRVRLQLQALEALLREHQHWRNDEPQPHQFNSTQPFFMDTMEPLEWLQWVLIPRMH
DLLDNKQPLPGAFAVAPYYEMALATDHPQRALILAELEKLDALFADDAS
              
                            

Download fasta file
RegulonDB