RegulonDB RegulonDB 10.8: Amino acid Sequence
SecY-interacting protein Amino Acid Sequence


Size: 181

Fasta

 

>SecY-interacting protein E. coli K12. Version NC_000913.3 GI:556503834
MDDLTAQALKDFTARYCDAWHEEHKSWPLSEELYGVPSPCIISTTEDAVYWQPQPFTGEQ
NVNAVERAFDIVIQPTIHTFYTTQFAGDMHAQFGDIKLTLLQTWSEDDFRRVQENLIGHL
VTQKRLKLPPTLFIATLEEELEVISVCNLSGEVCKETLGTRKRTHLASNLAEFLNQLKPL
L
              
                            

Download fasta file
RegulonDB