RegulonDB RegulonDB 10.8: Amino acid Sequence
7-cyano-7-deazaguanine reductase Amino Acid Sequence


Size: 282

Fasta

 

>7-cyano-7-deazaguanine reductase E. coli K12. Version NC_000913.3 GI:556503834
MSSYANHQALAGLTLGKSTDYRDTYDASLLQGVPRSLNRDPLGLKADNLPFHGTDIWTLY
ELSWLNAKGLPQVAVGHVELDYTSVNLIESKSFKLYLNSFNQTRFNNWDEVRQTLERDLS
TCAQGKISVALYRLDELEGQPIGHFNGTCIDDQDITIDNYEFTTDYLENATCGEKVVEET
LVSHLLKSNCLITHQPDWGSLQIQYRGRQIDREKLLRYLVSFRHHNEFHEQCVERIFNDL
LRFCQPEKLSVYARYTRRGGLDINPWRSNSDFVPSTTRLVRQ
              
                            

Download fasta file
RegulonDB