RegulonDB RegulonDB 10.8: Amino acid Sequence
TPR repeat-containing putative chaperone YgeG Amino Acid Sequence


Size: 163

Fasta

 

>TPR repeat-containing putative chaperone YgeG E. coli K12. Version NC_000913.3 GI:556503834
MSTETIEIFNNSDEWANQLKHALSKGENLALLHGLTPDILDRIYAYAFDYHEKGNITDAE
IYYKFLCIYAFENHEYLKDFASVCQPKKKYQQAYDLYKLSYNYFPYDDYSVIYRMGQCQI
GAKNIDNAMQCFYHIINNCEDDSVKSKAQAYIELLNDNSEDNG
              
                            

Download fasta file
RegulonDB