RegulonDB RegulonDB 10.10: Amino acid Sequence
mRNA interferase toxin MqsR Amino Acid Sequence


Size: 98

Fasta

 

>mRNA interferase / toxin of the MqsR-MqsA toxin-antitoxin system E. coli K12. Version NC_000913.3 GI:556503834
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTT
YSDHTIWQDVYRPRLVTGQVYLKITVIHDVLIVSFKEK
              
                            

Download fasta file
RegulonDB