RegulonDB RegulonDB 10.10: Amino acid Sequence
DUF2645 domain-containing inner membrane protein YgiZ Amino Acid Sequence


Size: 110

Fasta

 

>DUF2645 domain-containing inner membrane protein YgiZ E. coli K12. Version NC_000913.3 GI:556503834
MLKQKIKTIFEALLYIMLTYWLIDSFFAFNKYDWMLESGGNICSIPSVSGEDRILQAMIA
AFFLLTPLIILILRKLFMREMFEFWVYVFSLGICLVCGWWLFWGRFIFCY
              
                            

Download fasta file
RegulonDB