RegulonDB RegulonDB 10.10: Amino acid Sequence
modulator protein MzrA Amino Acid Sequence


Size: 127

Fasta

 

>modulator protein MzrA E. coli K12. Version NC_000913.3 GI:556503834
MQIPRMSLRQLAWSGAVLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLD
AHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQAMQWLTRLR
DNSHRFG
              
                            

Download fasta file
RegulonDB