RegulonDB RegulonDB 10.8: Amino acid Sequence
DoxX family protein Amino Acid Sequence


Size: 130

Fasta

 

>DoxX family protein E. coli K12. Version NC_000913.3 GI:556503834
MKKLEDVGVLVARILMPILFITAGWGKITGYAGTQQYMEAMGVPGFMLPLVILLEFGGGL
AILFGFLTRTTALFTAGFTLLTAFLFHSNFAEGVNSLMFMKNLTISGGFLLLAITGPGAY
SIDRLLNKKW
              
                            

Download fasta file
RegulonDB