RegulonDB RegulonDB 10.10: Amino acid Sequence
Type II secretion system protein GspE Amino Acid Sequence


Size: 493

Fasta

 

>Type II secretion system protein GspE E. coli K12. Version NC_000913.3 GI:556503834
MRIHSPYPASWALAQRIGYLYSEGEIIYLADTPFERLLDIQRQVGQCQTMTSLSQADFEA
RLEAVFHQNTGESQQIAQDIDQSVDLLSLSEEMPANEDLLNEDSAAPVIRLINAILSEAI
KETASDIHIETYEKTMSIRFRIDGVLRTILQPNKKLAALLISRIKVMARLDIAEKRIPQD
GRISLRIGRRNIDVRVSTLPSIYGERAVLRLLDKNSLQLSLNNLGMTAADKQDLENLIQL
PHGIILVTGPTGSGKSTTLYAILSALNTPGRNILTVEDPVEYELEGIGQTQVNTRVDMSF
ARGLRAILRQDPDVVMVGEIRDTETAQIAVQASLTGHLVLSTLHTNSASGAVTRLRDMGV
ESFLLSSSLAGIIAQRLVRRLCPQCRQFTPVSPQQAQMFKYHQLAVTTIGTPVGCPHCHQ
SGYQGRMAIHEMMVVTPELRAAIHENVDEQALERLVRQQHKALIKNGLQKVISGDTSWDE
VMRVASATLESEA
              
                            

Download fasta file
RegulonDB