RegulonDB RegulonDB 11.1: Amino acid Sequence
putative RNA-binding protein YhgF Amino Acid Sequence


Size: 773

Fasta

 

>putative RNA-binding protein YhgF E. coli K12. Version NC_000913.3 GI:556503834
MMNDSFCRIIAGEIQARPEQVDAAVRLLDEGNTVPFIARYRKEITGGLDDTQLRNLETRL
SYLRELEERRQAILKSISEQGKLTDDLAKAINATLSKTELEDLYLPYKPKRRTRGQIAIE
AGLEPLADLLWSDPSHTPEVAAAQYVYADKGVADTKAALDGARYILMERFAEDAALLAKV
RDYLWKNAHLVSTVVSGKEEEGAKFRDYFDHHEPLSTVPSHRALAMFRGRNEGVLQLSLN
ADPQFDEPPKESYCEQIIMDHLGLRLNNAPADSWRKGVVSWTWRIKVLMHLETELMGTVR
ERAEDEAINVFARNLHDLLMAAPAGLRATMGLDPGLRTGVKVAVVDATGKLVATDTIYPH
TGQAAKAAMTVAALCEKHNVELVAIGNGTASRETERFYLDVQKQFPKVTAQKVIVSEAGA
SVYSASELAAQEFPDLDVSLRGAVSIARRLQDPLAELVKIDPKSIGVGQYQHDVSQTQLA
RKLDAVVEDCVNAVGVDLNTASVPLLTRVAGLTRMMAQNIVAWRDENGQFQNRQQLLKVS
RLGPKAFEQCAGFLRINHGDNPLDASTVHPEAYPVVERILAATQQALKDLMGNSSELRNL
KASDFTDEKFGVPTVTDIIKELEKPGRDPRPEFKTAQFADGVETMNDLQPGMILEGAVTN
VTNFGAFVDIGVHQDGLVHISSLSNKFVEDPHTVVKAGDIVKVKVLEVDLQRKRIALTMR
LDEQPGETNARRGGGNERPQNNRPAAKPRGREAQPAGNSAMMDALAAAMGKKR
              
                            

Download fasta file
RegulonDB