RegulonDB RegulonDB 10.10: Amino acid Sequence
iron-sulfur cluster carrier protein NfuA Amino Acid Sequence


Size: 191

Fasta

 

>iron-sulfur cluster carrier protein NfuA E. coli K12. Version NC_000913.3 GI:556503834
MIRISDAAQAHFAKLLANQEEGTQIRVFVINPGTPNAECGVSYCPPDAVEATDTALKFDL
LTAYVDELSAPYLEDAEIDFVTDQLGSQLTLKAPNAKMRKVADDAPLMERVEYMLQSQIN
PQLAGHGGRVSLMEITEDGYAILQFGGGCNGCSMVDVTLKEGIEKQLLNEFPELKGVRDL
TEHQRGEHSYY
              
                            

Download fasta file
RegulonDB