RegulonDB RegulonDB 10.9: Amino acid Sequence
L-ascorbate-6-phosphate lactonase Amino Acid Sequence


Size: 354

Fasta

 

>L-ascorbate-6-phosphate lactonase E. coli K12. Version NC_000913.3 GI:556503834
MSKVKSITRESWILSTFPEWGSWLNEEIEQEQVAPGTFAMWWLGCTGIWLKSEGGTNVCV
DFWCGTGKQSHGNPLMKQGHQMQRMAGVKKLQPNLRTTPFVLDPFAIRQIDAVLATHDHN
DHIDVNVAAAVMQNCADDVPFIGPKTCVDLWIGWGVPKERCIVVKPGDVVKVKDIEIHAL
DAFDRTALITLPADQKAAGVLPDGMDDRAVNYLFKTPGGSLYHSGDSHYSNYYAKHGNEH
QIDVALGSYGENPRGITDKMTSADMLRMGEALNAKVVIPFHHDIWSNFQADPQEIRVLWE
MKKDRLKYGFKPFIWQVGGKFTWPLDKDNFEYHYPRGFDDCFTIEPDLPFKSFL
              
                            

Download fasta file
RegulonDB