RegulonDB RegulonDB 10.10: Amino acid Sequence
iron-sulfur cluster repair protein YtfE Amino Acid Sequence


Size: 220

Fasta

 

>iron-sulfur cluster repair protein YtfE E. coli K12. Version NC_000913.3 GI:556503834
MAYRDQPLGELALSIPRASALFRKYDMDYCCGGKQTLARAAARKELDVEVIEAELAKLAE
QPIEKDWRSAPLAEIIDHIIVRYHDRHREQLPELILQATKVERVHADKPSVPKGLTKYLT
MLHEELSSHMMKEEQILFPMIKQGMGSQAMGPISVMESEHDEAGELLEVIKHTTNNVTPP
PEACTTWKAMYNGINELIDDLMDHISLENNVLFPRALAGE
              
                            

Download fasta file
RegulonDB