RegulonDB RegulonDB 10.9: Amino acid Sequence
N-acetylneuraminic acid outer membrane channel Amino Acid Sequence


Size: 238

Fasta

 

>N-acetylneuraminic acid outer membrane channel E. coli K12. Version NC_000913.3 GI:556503834
MKKAKILSGVLLLCFSSPLISQAATLDVRGGYRSGSHAYETRLKVSEGWQNGWWASMESN
TWNTIHDNKKENAALNDVQVEVNYAIKLDDQWTVRPGMLTHFSSNGTRYGPYVKLSWDAT
KDLNFGIRYRYDWKAYRQQDLSGDMSRDNVHRWDGYVTYHINSDFTFAWQTTLYSKQNDY
RYANHKKWATENAFVLQYHMTPDITPYIEYDYLDRQGVYNGRDNLSENSYRIGVSFKL
              
                            

Download fasta file
RegulonDB