RegulonDB RegulonDB 10.10: Amino acid Sequence
ferric-siderophore reductase FhuF Amino Acid Sequence


Size: 262

Fasta

 

>hydroxamate siderophore iron reductase E. coli K12. Version NC_000913.3 GI:556503834
MAYRSAPLYEDVIWRTHLQPQDPTLAQAVRATIAKHREHLLEFIRLDEPAPLNAMTLAQW
SSPNVLSSLLAVYSDHIYRNQPMMIRENKPLISLWAQWYIGLMVPPLMLALLTQEKALDV
SPEHFHAEFHETGRVACFWVDVCEDKNATPHSPQHRMETLISQALVPVVQALEATGEING
KLIWSNTGYLINWYLTEMKQLLGEATVESLRHALFFEKTLTNGEDNPLWRTVVLRDGLLV
RRTCCQRYRLPDVQQCGDCTLK
              
                            

Download fasta file
RegulonDB