RegulonDB RegulonDB 10.10: Amino acid Sequence
D-glucoronate/D-galacturonate isomerase Amino Acid Sequence


Size: 470

Fasta

 

>D-glucoronate/D-galacturonate isomerase E. coli K12. Version NC_000913.3 GI:556503834
MTPFMTEDFLLDTEFARRLYHDYAKDQPIFDYHCHLPPQQIAEDYRFKNLYDIWLKGDHY
KWRAMRTNGVAERLCTGDASDREKFDAWAATVPHTIGNPLYHWTHLELRRPFGITGKLLS
PSTADEIWNECNELLAQDNFSARGIMQQMNVKMVGTTDDPIDSLEHHAEIAKDGSFTIKV
LPSWRPDKAFNIEQATFNDYMAKLGEVSDTDIRRFADLQTALTKRLDHFAAHGCKVSDHA
LDVVMFAEANEAELDSILARRLAGETLSEHEVAQFKTAVLVFLGAEYARRGWVQQYHIGA
LRNNNLRQFKLLGPDVGFDSINDRPMAEELSKLLSKQNEENLLPKTILYCLNPRDNEVLG
TMIGNFQGEGMPGKMQFGSGWWFNDQKDGMERQMTQLAQLGLLSRFVGMLTDSRSFLSYT
RHEYFRRILCQMIGRWVEAGEAPADINLLGEMVKNICFNNARDYFAIELN
              
                            

Download fasta file
RegulonDB