RegulonDB RegulonDB 10.9: Amino acid Sequence
acetolactate synthase II subunit IlvG Amino Acid Sequence


Size: 547

Fasta

 

>acetolactate synthase II subunit IlvG, N-terminal fragment (pseudogene) E. coli K12. Version NC_000913.3 GI:556503834
MNGAQWVVHALRAQGVNTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARA
TGKTGVCIATSGPGATNLITGLADALLDSIPVVAITGQVSAPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLEELPRIMAEAFDVACSGRPGPVLVDIPKDIQLASGDLEPWFTTVENEVT
FPHAEVEQARQMLAKAQKPMLYVGGGVGMAQAVPALREFLAATKMPATCTLKGLGAVEAD
YPYYLGMLGMHGTKAANFAVQECDLLIAVGARFDDRVTGKLNTFAPHASVIHMDIDPAEM
NKLRQAHVALQGDLNALLPALQQPLNQ*LAATLRAAA**TFLALRPSR*RYLRAVVVKTT
VGS*TCGLRRDHRCGAAPDVGCAAHRPHSPGKFHHLQRFRYHGFWFTGGGWRTSRATERY
RCLYLR*RLFHDECARAGHRKTQAVTVENRLTR*PTVRDGSTMAATVFSGTIQRNHPY**
PRFPHVSQRLRHPWPTHHPERPG*SGTRHHAEQ*WAIPASCLNRRT*ERLAAGAAWRQ*F
RNVGEII
              
                            

Download fasta file
RegulonDB