RegulonDB RegulonDB 11.1: Amino acid Sequence
mRNA interferase toxin HicA Amino Acid Sequence


Size: 58

Fasta

 

>toxin of the HicA-HicB toxin-antitoxin system E. coli K12. Version NC_000913.3 GI:556503834
MKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
              
                            

Download fasta file
RegulonDB